Reverse dna
here is the transcribed rna
entered dna sequence and choice trns First reading frame (+1) second reading frame(+2) third reading frame(+3) First reading frame (-1) second reading frame(-2) third reading frame(-3) wrong choice
random nucleo. ending with D
protine MNIDDKLEGLFLKCGGIDEMQSSRTMVVMGGVSGQSTVSGELQD SVLQDRSMPHQEILAADEVLQESEMRQQDMISHDELMVHEETVKNDEEQMETHERLPQ GLQYALNVPISVKQEITFTDVSEQLMRDKKQIR central dogma
-
-
-
Enter t for transcription OR r for translation and DNA sequence... 

more info.

random Nucleo